PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009588532.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 245aa    MW: 28095.9 Da    PI: 6.2629
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009588532.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.41e-173687556
                    SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                    ++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ +q+ +WFqNrRa++k
  XP_009588532.1 36 RRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPKQIAIWFQNRRARWK 87
                    57899**********************************************9 PP

2HD-ZIP_I/II123.59.9e-4034125293
     HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     k rrl+ eqvk+LE++Fe  +kLeperK++lar+Lglqp+q+a+WFqnrRAR+ktkqlEkdy++Lkr+++a+k+en++L +++++L++++++
  XP_009588532.1  34 KIRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPKQIAIWFQNRRARWKTKQLEKDYDVLKRQLEAVKAENDSLLAHNQKLHAKIMA 125
                     669************************************************************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.99E-192691IPR009057Homeodomain-like
PROSITE profilePS5007116.8922989IPR001356Homeobox domain
SMARTSM003892.3E-163293IPR001356Homeobox domain
CDDcd000861.63E-143390No hitNo description
PfamPF000464.3E-153687IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.1E-193796IPR009057Homeodomain-like
PRINTSPR000311.1E-56069IPR000047Helix-turn-helix motif
PROSITE patternPS0002706487IPR017970Homeobox, conserved site
PRINTSPR000311.1E-56985IPR000047Helix-turn-helix motif
PfamPF021837.6E-1489128IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MSFSGMEANN NCEENHEEED LCDDGLHEAA REKKIRRLNM EQVKTLEKNF ELGNKLEPER  60
KMQLARALGL QPKQIAIWFQ NRRARWKTKQ LEKDYDVLKR QLEAVKAEND SLLAHNQKLH  120
AKIMALKSGE QPTELSINLN KETEGSSSEN SSEMMKLDST MTAAAIDGPL ILVSTAHQPI  180
TRGSRLLFPP PVRPNGVAQL FQRQQVLQSD MKLMDQTVKQ ETLSNMFVDD QSPGFWPWLE  240
QPHFN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18189RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2402022e-62AC240202.4 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-227k19 map 1, complete sequence.
GenBankAC2458352e-62AC245835.5 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone sle-8i3 map 1, complete sequence.
GenBankAC2467092e-62AC246709.3 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone slm-58g10 map 1, complete sequence.
GenBankHG9754402e-62HG975440.1 Solanum pennellii chromosome ch01, complete genome.
GenBankHG9755132e-62HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009588531.10.0PREDICTED: homeobox-leucine zipper protein ATHB-13-like isoform X2
RefseqXP_009588532.10.0PREDICTED: homeobox-leucine zipper protein ATHB-13-like isoform X2
RefseqXP_009588533.10.0PREDICTED: homeobox-leucine zipper protein ATHB-13-like isoform X2
RefseqXP_009588534.10.0PREDICTED: homeobox-leucine zipper protein ATHB-13-like isoform X2
SwissprotQ8LC035e-74ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLM1CEL24e-97M1CEL2_SOLTU; Uncharacterized protein
STRINGSolyc05g007180.2.19e-96(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.15e-66HD-ZIP family protein